★★★★★
★★★★★
Verified Buyer
It was my first time ordering from this company and the process was quick and easy.
Uso del prodotto: Questo prodotto è destinato esclusivamente alla ricerca.
Tutte le informazioni sui prodotti presenti su questo sito hanno scopo esclusivamente educativo. Qualsiasi forma di introduzione nel corpo di esseri umani o animali è severamente vietata dalla legge. Questo prodotto deve essere maneggiato solo da professionisti abilitati e qualificati. Non è un farmaco, un alimento o un cosmetico e non deve essere etichettato, utilizzato o presentato come tale.
Purezza del 99% garantita
Solo per uso di ricerca
Checkout sicuro
GLP-2 (Teduglutide / GLP-2 Analogue 5mg Lyophilized Vial)
GLP-2 (Glucagon-Like Peptide-2) 5mg lyophilized peptide standard for intestinal mucosal, crypt cell, and gastrointestinal barrier research.
Stessa formula affidabile. Nuovo look.
Durante il cambio di confezione potresti ricevere prodotti con l’etichetta precedente o con quella nuova. Formulazione, purezza e qualità restano esattamente le stesse, secondo i nostri standard.
Metodi di pagamento accettati
- Carta di credito
- Bonifico bancario (SEPA istantaneo)
- Bonifico bancario (ACH)
- Wise
- Revolut
- Zelle
- Remitly
- Western Union
- Chime
- Altri metodi
-25% su tutto – fino al 31 Ottobre
25% sui prezzi ordinari, in sostituzione degli altri saldi. Cumulabile solo con lo sconto crypto.
Spedizione
Spedizione in giornata per gli ordini USA effettuati entro le 12:00 EST.
Vedi le condizioni di spedizione →Testato in laboratorio
Ogni lotto è testato per purezza, potenza e qualità.
Vedi i risultati di laboratorio →Panoramica
Peptide Monograph: GLP-2 (33 Amino Acids)
Glucagon-Like Peptide-2 (GLP-2) is a 33-amino-acid peptide co-secreted with GLP-1 from intestinal L-cells. It selectively activates the GLP-2 receptor in enteric neurons and subepithelial myofibroblasts, promoting mucosal growth, crypt cell proliferation, and mesenteric blood flow.
Proprietà
- Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITD
- Molecular Weight: 3752.1 g/mol
- Purity: ≥98.0% HPLC
- Format: 5mg Lyophilized Cake in 3ml sterile vial
- Reconstitution: Reconstitute with 1.0ml sterile bacteriostatic water.
- Storage: Store at -20°C. Protect from moisture and light.
Customer Reviews (8)
★★★★★
★★★★★
5 / 5
★★★★★
★★★★★
Verified Buyer
The quality is excellent, and the delivery was prompt.
★★★★★
★★★★★
Verified Buyer
Surpasses all competitors—best product ever.
★★★★★
★★★★★
Verified Buyer
Finally a place to trust. Definitely a bi-weekly customer here.
★★★★★
★★★★★
Verified Buyer
Fast shipping , great value. My current source and a good one. Reliable shipping, I never have to track rest assured it will show up in my mailbox in 2 to 3 days.
★★★★★
★★★★★
Verified Buyer
Exceptional service on the super fast shipping, quality is stellar. I will definitely be back. Results from my tests exceeded all expectations.
★★★★★
★★★★★
Verified Buyer
Highly satisfied with the fast turnaround times, it's an exceptionally pure batch. My laboratory research results exceeded expectations. Excellent all-round service.
★★★★★
★★★★★
Verified Buyer
Top-notch quality from the support team and the quality is absolutely top-tier. Our research results are completely exceeding expectations. Thanks for the outstanding support!
